SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000072 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000072
Domain Number 1 Region: 16-99
Classification Level Classification E-value
Superfamily Immunoglobulin 1.1e-20
Family I set domains 0.0000146
Further Details:      
 
Domain Number 2 Region: 105-204
Classification Level Classification E-value
Superfamily Immunoglobulin 2.85e-17
Family I set domains 0.00000359
Further Details:      
 
Domain Number 3 Region: 311-383
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000131
Family Protein kinases, catalytic subunit 0.0000464
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000072   Gene: ENSNLEG00000000063   Transcript: ENSNLET00000000080
Sequence length 384
Comment pep:known_by_projection supercontig:Nleu1.0:GL397450.1:203683:208053:1 gene:ENSNLEG00000000063 transcript:ENSNLET00000000080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGKEFRGEHRIGGIKLRH
QQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLG
SDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHN
DAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEPDEAGSVYAGVLSYGAGFFLFILVVAA
VTLCRLRSPPKKGLGSPTVHKISRFPLKRQVSLESNASMSSNTPLVRIARLSSGEGPTLA
NVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKD
DATYKDLSDLVSEMEMMKMIGKHK
Download sequence
Identical sequences ENSNLEP00000000072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]