SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000092 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000000092
Domain Number - Region: 39-117
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00105
Family I set domains 0.065
Further Details:      
 
Domain Number - Region: 141-211
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0545
Family I set domains 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000092   Gene: ENSNLEG00000000084   Transcript: ENSNLET00000000101
Sequence length 265
Comment pep:known_by_projection supercontig:Nleu1.0:GL397434.1:909492:929424:1 gene:ENSNLEG00000000084 transcript:ENSNLET00000000101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPGLLCLAVLAASSFSKVQEEDITPVVSIAYKVLEVFPKGRRVLITCHAPQAPPPISY
SLCGTKNIKVAKKLVKTHEPASFNLNITLKSSPDLLTYFCRAASTSGAHVDSARLQMYWE
LWSKPVSELQANFTLRDRGSGPRVEMSCQAFSGSPPITYSLVGKDGQVHLQQRPRHGQPA
NFSFLPSQTLDWFQCQAANNISVQHSALTLVPPGRDQKMEDWQGSLESPILALPPYRSTH
RLSEEEFGGFRIGNGEVRGHKATAM
Download sequence
Identical sequences G1QGR5
ENSNLEP00000000092 ENSNLEP00000000092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]