SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000101 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000101
Domain Number 1 Region: 5-121
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.31e-27
Family Type II thymidine kinase 0.00000149
Further Details:      
 
Domain Number 2 Region: 121-166
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000356
Family Type II thymidine kinase zinc finger 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000101   Gene: ENSNLEG00000000089   Transcript: ENSNLET00000000110
Sequence length 205
Comment pep:known_by_projection supercontig:Nleu1.0:GL397434.1:939711:950439:-1 gene:ENSNLEG00000000089 transcript:ENSNLET00000000110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSCSTELMRRVRRFQIAQYKCLVIKYAKDTRYSSSFCTHDRNTMEALPACLLRDVAEAL
GVAVIGIXXXXXFPDIVEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLVPLAESVVKL
TAVCMECFREAAYTKRLGTEKEVEVIGGADKYHSVCRLCYFKKTSGQPAGPDNKENCPVP
GKPGEAVAARKLFAPQQILQCSPAN
Download sequence
Identical sequences ENSNLEP00000000101 ENSNLEP00000000101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]