SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000112 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000112
Domain Number 1 Region: 188-502
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.24e-48
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0061
Further Details:      
 
Domain Number 2 Region: 71-168
Classification Level Classification E-value
Superfamily ISP domain 1.57e-26
Family Rieske iron-sulfur protein (ISP) 0.028
Further Details:      
 
Domain Number 3 Region: 506-584
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 7e-21
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000112   Gene: ENSNLEG00000000085   Transcript: ENSNLET00000000123
Sequence length 605
Comment pep:known_by_projection supercontig:Nleu1.0:GL397544.1:39327:53827:-1 gene:ENSNLEG00000000085 transcript:ENSNLET00000000123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGCFSKPKPVELKIEVVLPEKERGKEELSASGKGSPRAYQGNGTARHFHTEERLSTPHP
YPSPQDCVEAAVCHVKDLENGQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGV
LSRGRVRCPWHGACFNISTGDLEDFPGLDSLHKFQVKIEKEKVYVRASKQALQLQRRTKV
MAKCISPSAGYSSSTNVLIVGAGAAGLVCAETLRQEGFSDRIVLCTLDRHLPYDRPKLSK
SLDTQPEQLALRPKEFFRAYGIEVLTEAQVVTVDVRNKKVVFKDGFKLEYSKLLLAPGSS
PKTLSCKGKEVENVFTIRTPEDANRVVRLARGRNVVVVGAGFLGMEVAAYLTEKAHSVSV
VELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRGQEGKLKEVVLKSSKVVRA
DVCVVGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRK
VNIPHWQMAHAQGRVAAQNMLAQEAEMSTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDL
EELKFVAFYTKGDEVIAVASMNYDPIVSKVAEVLASGRAIRKREVELFVLHSKTGDMSWL
TGKGS
Download sequence
Identical sequences G1QGT5
ENSNLEP00000000112 XP_012363554.1.23891 XP_012363555.1.23891 ENSNLEP00000000112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]