SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000182 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000182
Domain Number 1 Region: 131-183
Classification Level Classification E-value
Superfamily RING/U-box 1.5e-18
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000182   Gene: ENSNLEG00000000160   Transcript: ENSNLET00000000197
Sequence length 190
Comment pep:known_by_projection supercontig:Nleu1.0:GL397450.1:881641:927694:1 gene:ENSNLEG00000000160 transcript:ENSNLET00000000197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTRKRRGGAINSRQAQKRTREATSTPEISLEAEPIELVETAGDEIVDLTCESLEPVVVD
LTHNDSVVVSDERRRPRRNARRLPQDHADSCVVSSDDEELSRDRDVYVTTHTPRNARDEG
TTGLRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKI
NHKRYHPIYI
Download sequence
Identical sequences ENSNLEP00000000182 ENSNLEP00000000182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]