SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000243 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000243
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily Immunoglobulin 2.23e-16
Family I set domains 0.0016
Further Details:      
 
Domain Number 2 Region: 95-166
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000447
Family I set domains 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000243   Gene: ENSNLEG00000000213   Transcript: ENSNLET00000000261
Sequence length 184
Comment pep:novel contig::ADFV01134967.1:48713:60379:1 gene:ENSNLEG00000000213 transcript:ENSNLET00000000261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTISLTKVELSVGESKFFTCTAIGEPESIDWYNPQGEKIISTQRIVVQKEGVRSRLTIYN
ANIEDAGIYRCQATDAKGQTQEATVVLEIYQKLTFREVVSPQEFKQGEDAEVVCRVSSSP
APAVSWLYHNEEVTTISDNRFAMLANNNLQILNINKSDEGIYRCEGRVEARGEIDFRDII
VIVN
Download sequence
Identical sequences ENSNLEP00000000243 ENSNLEP00000000243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]