SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000290 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000290
Domain Number 1 Region: 634-1078
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.8e-59
Family Tandem AAA-ATPase domain 0.07
Further Details:      
 
Domain Number 2 Region: 180-209
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000017
Family CCCH zinc finger 0.003
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000000290
Domain Number - Region: 9-84
Classification Level Classification E-value
Superfamily TPR-like 0.00367
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000290   Gene: ENSNLEG00000000218   Transcript: ENSNLET00000000309
Sequence length 1942
Comment pep:known_by_projection supercontig:Nleu1.0:GL397319.1:10324:165185:1 gene:ENSNLEG00000000218 transcript:ENSNLET00000000309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDRRAEKSCEQACESLKRQDYEMALKHCTEALLSLGQYSMVDFTGPCPLEIERIKIESL
LYRIASFLQLKNYVQADEDCRHVLGEGVAKGEDAFRAVLCCMQLKGKLQPVSTILAKSLT
GESLNGMVTKDLTRLKTLLSETETATSNALSGYHVEDLDEGSCNGWHFRPPPRGITSSEE
YTLCKRFLEQGICRYGAQCTSAHSQEELAEWQKRYASRLIKLKQQNENKQLSGSYMETLI
EKWMNSLSPEKVLSECIEGVKVEHNPDLSVTVSTKKSHQTWTFALTCKPARMLYRVALLY
DAHRPHFSIIAISAGDSTTQVSQEVPENCQEWIGGKMAQNGLDHYVYKVGIAFNTEIFGT
FRQTIVFDFGLEPVLMQRVMIDAASTEDLEYLMHAKQQLVTTAKRWDSSSKTIIDFEPNE
TTDLEKSLLIRYQIPLSADQLFTQSVLDKSLTKSNYQSRLHDLLYIEEIAQYKEISKFNL
KVQLQILASFMLTGVSGGAKYAQNGQLFGRFKLTETLSEDTLAGRLVMTKVNAVYLLPVP
KQKLVQTQGTKEKVYEATIEEKTKEYIFLRLSRECCEELNLRPDCDTQVELQFQLNRLPL
CEMHYALDRIKDNGVLFPDISMTPTIPWSPNRQWDEQLDPRLNAKQKEAVLAITTPLAIQ
LPPVLIIGPYGTGKTFTLAQAVKHILQQQETSRILICTHSNSAADLYIKDYLHPYVEAGN
PQARPLRVYFRNRWVKTVHPVVHQYCLISSAHSTFQMPQKEDILKHRVVVVTLNTSQYLC
QLDLEPGFFTHILLDEAAQAMECETIMPLALATQNTRIVLAGDHMQLSPFVYSEFARERN
LHVSLLDRLYEHYPAEFPCRILLCENYRSHEAIINYTSELFYEGKLMASGKQPAHKDFYP
LTFFTARGEDVQEKNSTAFYNNAEVFEVVERVEELRRKWPVAWGKLDDGSIGVVTPYADQ
VFRIRAELRKKRLSDVNVERVLNVQGKQFRVLFLSTVRTRHTCKHKQTPIKKKEQLLEDS
TEDLDYGFLSNYKLLNTAITRAQSLVAVVGDPIALCSVGRCRKFWERFIALCHENNNLHG
ITFEQIKAQLEALELKKTYVLNPLAPEFIPRALRLQHSGSTNKQQQSPPKGKSLHHTQND
HFQNDGIVQPNPSVLIGNPIRAYTPPPALGPHPNLGKSPSPVQRIDPHTGTSILYVPAVY
GGNVVMSVPLPVPWTGYQGRFAVDPRIITHQAAMAYNMNLLQTHGRGSPIPYGLGHHPPV
TIGQPQNQHQEKDQHEQNRNGKSDTNNSGPEINKIRTPEKKPTEPKQVDLESNPQNRSPE
SRPSVVYPSTKFPRKDNLNPRHINLPLPAPHAQYAIPNRHFHPLPQLPRPPFPIPQQHTL
LNQQQNNLPEQPNQMPPQPNQVVQQQSQLNQQPQQPPPQLSPAYQAGPNNAFFNSAVAHR
PQSPAEAVIPEQQPPPMLQEGHSPLRAIAQPGPILPSHLNSFIDENPSGLPIGEALDRIH
GSVTLETLRQQQARFQQWSEHHAFLNQGSVPYPHHHHPHLQHLPQPPLGLHQPPVRADWK
LTSSAEDEVETTYSRFQDLIRELSHRDQSETRELAEMPPPQSRLLQYRQVQTRSPPAVPS
PPSSTDHSSHFSNFNDNSRDLEVASNPAFPQRLPPQIFNSPFSLPSEHLAPPPLKYLAPD
GAWTFANLQQNHLMGPGFPYGLPPLPHRPPQNPFVQIQNHQHAIGQEPFHPLSSRTVSSS
SLPSLEEYEPRGPGRPLYQRRISSSSVQPCSEEVSTPQDSLAQCKELQDHSNQSSFNFSS
PESWVNTTSSTPYQNIPCNGSSRTAQPRELIAPPKTVKPPEDQLKSENLEVSSSFNYSVL
QHLGQFPPLMPNKQIAESANSSSPQSSAGGKPAMSYASALRAPPKPRPPPEQAKKSSDPL
SLFQELSLGSSSGSNGFYSYFK
Download sequence
Identical sequences G1QHA3
XP_012358177.1.23891 ENSNLEP00000000290 ENSNLEP00000000290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]