SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000292 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000292
Domain Number 1 Region: 17-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000084
Family Thioltransferase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000292   Gene: ENSNLEG00000000243   Transcript: ENSNLET00000000311
Sequence length 198
Comment pep:known_by_projection supercontig:Nleu1.0:GL397470.1:1754971:1760553:1 gene:ENSNLEG00000000243 transcript:ENSNLET00000000311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTVDLARVGACILKHAVTGEAVELRSLWRERACVVAGLRRFGCVVCRWIAQDLSSLAGL
LHQHGVRLVGVGPEALGLQEFLDGDYFAGELYLDESKQLYKELGFKRYNSLSIVPAALGK
PVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQKSPGDYVPKEHILQVL
GISAEVCASDPPQCDREV
Download sequence
Identical sequences ENSNLEP00000000292 XP_012354005.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]