SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000328 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000328
Domain Number 1 Region: 27-124
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000719
Family V set domains (antibody variable domain-like) 0.00000576
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000000328
Domain Number - Region: 142-221
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0283
Family C2 set domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000328   Gene: ENSNLEG00000000277   Transcript: ENSNLET00000000352
Sequence length 329
Comment pep:known_by_projection supercontig:Nleu1.0:GL397380.1:498843:586380:1 gene:ENSNLEG00000000277 transcript:ENSNLET00000000352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPQCTMGLSNTLFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNRSLSELVVFWQDQ
ENLVLNEVYLGKEKFDSVHSKYMGRTSFDPDSWTLRLHNLQIKDKGLYQCIIHHKKPTGM
IRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTI
EYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCVLETDKIRLLSSPFSIELEDRQ
PPPDHIPWITAVFPTVIICVMVFCLILWKWKKKKQPRNSYKCGTNTMEREEREQTKKRER
IHIPERSDEAQHVFKSSKTPSCDKSDTCF
Download sequence
Identical sequences G1QHE1
XP_003275564.1.23891 ENSNLEP00000000328 ENSNLEP00000000328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]