SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000341 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000341
Domain Number 1 Region: 264-345
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.19e-20
Family Complement control module/SCR domain 0.00000333
Further Details:      
 
Domain Number 2 Region: 83-149
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.87e-17
Family Complement control module/SCR domain 0.0000264
Further Details:      
 
Domain Number 3 Region: 205-267
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000058
Family Complement control module/SCR domain 0.0000167
Further Details:      
 
Domain Number 4 Region: 140-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000202
Family Complement control module/SCR domain 0.0000258
Further Details:      
 
Domain Number 5 Region: 22-93
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000089
Family Complement control module/SCR domain 0.0000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000341   Gene: ENSNLEG00000000285   Transcript: ENSNLET00000000365
Sequence length 345
Comment pep:known_by_projection supercontig:Nleu1.0:GL397319.1:1029117:1047054:1 gene:ENSNLEG00000000285 transcript:ENSNLET00000000365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISPVLILFSSFLCHVAIAGRTCPKPDALPFSTVLPLKTFYEPGEEITYSCKPGYVSRGG
MRKFICPVTGMWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGTN
SAKCTEEGKWSPELPVCAPITCPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAM
FGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSL
DGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFC
KNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
Download sequence
Identical sequences G1QHF4
XP_003268711.1.23891 ENSNLEP00000000341 ENSNLEP00000000341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]