SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000365 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000365
Domain Number 1 Region: 78-247
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.93e-53
Family Dual specificity phosphatase-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000365   Gene: ENSNLEG00000000306   Transcript: ENSNLET00000000390
Sequence length 377
Comment pep:known_by_projection supercontig:Nleu1.0:GL397319.1:1432526:1505489:-1 gene:ENSNLEG00000000306 transcript:ENSNLET00000000390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNSEMLERGVGGCRVSSGLGSYPGTEGARLVLSAGLALGGRLLGTHMSQWHHPRSGWGR
RRDFSGRSSAKKKGGNHIPERWKDYLPVGQRMPGTRFIAFKVPLQKSFEKKLAPEECFSP
LDLFNKIREQNEELGLIIDLTYTQRYYKPEDLPETIPYLKIFTVGHQVPDDETIFKFKHA
VNGFLKENKDNDKLIGVHCTHGLNRTGYLICRYLIDVEGVRPDDAIELFNRCRGHCLERQ
NYIEDLQNGPIRKNWNSSVSRSSGFEDSAHLMQPVHNKPVKQGPRYNLHQIQGHSAPRHF
HTQTQNLQQSVRKFSENPHVYQRRHLPPPGPPGEDCSHRRYSWNVKPNASRAAEDRRRWY
PYNYSGLSYPACWEWTQ
Download sequence
Identical sequences ENSNLEP00000000365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]