SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000386 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000386
Domain Number 1 Region: 130-201,330-405
Classification Level Classification E-value
Superfamily Immunoglobulin 4.85e-19
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 33-113
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000183
Family V set domains (antibody variable domain-like) 0.038
Further Details:      
 
Domain Number 3 Region: 220-313
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000011
Family V set domains (antibody variable domain-like) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000386   Gene: ENSNLEG00000000319   Transcript: ENSNLET00000000411
Sequence length 536
Comment pep:known_by_projection supercontig:Nleu1.0:GL397363.1:6539873:6582721:-1 gene:ENSNLEG00000000319 transcript:ENSNLET00000000411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGGRTHEPRVLVCLGALLASWVAVGLDAVVIGEVHENVTLHCGSISGLRGLVTWYRND
SEPVFLLSSNSSLQPAEPRFSLVDATSLHIESLSLGDEGNYTCQEILNVTQWFQVWLQVA
SGPYQIEVHIVATGTLPNGTLYAARGSHVDFSCNSSSRPPPMVEWWFQALNSSSESFGHN
LTVNSFSLLLMSPNLQGNYTCLAMNLLSKRHRKVTTELLVYYPPPSAPQCWAQMVSGSFM
LQLTCRWDGGYPDPDFLWIEEPGGVIVGKSKLGVEMLSESQLSDGKKFKCVTNHIVGPES
GASCVVQISESVLLXEPMKTCFVGNVTLTCQVSGAYPPAKILWLRNLTQPKVVMQPSSRH
LITQDGQNSTLTIHNCSQDLDEGYYVCRADSAVGVREVEIWLSVREPLNIGGIVGTIVSL
LLLGLAITSGLLLYYSPVFCWKAPLEIRGQNMDDVMVLVDSEEEEEEEQEDAAVEEEEGA
HEREELPKERPKQDHIHRVTALVNGNIEQMGNGFQDLQDDSSEEQSDIVQEEDRPV
Download sequence
Identical sequences ENSNLEP00000000386 ENSNLEP00000000386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]