SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000454 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000000454
Domain Number - Region: 356-380
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0136
Family CCCH zinc finger 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000454   Gene: ENSNLEG00000000383   Transcript: ENSNLET00000000483
Sequence length 836
Comment pep:known_by_projection supercontig:Nleu1.0:GL397348.1:3337477:3353829:1 gene:ENSNLEG00000000383 transcript:ENSNLET00000000483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTATAEVETPKMEKSASKEEKQQPKQDSTEQGNADSEDWMSSESDPEQISLKSSDNSKSC
QPRDGQLKKKEMHSKPHRQLCRSPCLDRPSFSQSSILQDGKLDLEKEYQAKMEFALKLGY
AEEQIQSVLNKLGPESLINDVLAELVRLGNKGDSEGQINLSLLVPRGPSSREIASPELSL
EDEIDNSDNLRPVVIDGSNVAMSHGNKEEFSCRGIQLAVDWFLDKGHKDITVFVPAWRKE
QSRPDAPITDQDILRKLEKEKILVFTPSRRVQGRRVVCYDDRFIVKLAFDSDGIIVSNDN
YRDLQVEKPEWKKFIEERLLMYSFVNDKFMPPDDPLGRHGPSLENFLRKRPIVPEHKKQP
CPYGKKCTYGHKCKYYHPERANQPQRSVADELRISAKLSTVKTMSEGTLAKCGTGMSSAK
GEITSEVKRVAPKRQSDPSIRSVAVEPEEWLSIARKPEASSVPSLVTALSVPTIPPPKSH
AVGALNTRSASSPVPGSSHFPHQKASLEHMASMQYPPILVTNSHGTPISYAEQYPKFESM
GDHGYYSMLGDFSKLNINSMHNREYYMAEVDRGVYARNPNLCPDSRVSHTRNDNYSSYNN
VYLAVADTHPEGNLKLHRSASQNRLQPFPHGYHEALTRVQSYGPEDSKQGPHKQSVPHLA
LHAQHPSTGTRSSCPADYPMPPNIHPGATPQPGRALVMTRMDSISDSRLYESNPVRQRRP
PLCREQHASWDPLPCATDSYGYHSYPLSNSLMQPCYEPVMVRSVPEKMEQLWRNPWVGMC
NDSREHMIPEHQYQTYKNLCNIFPSNIVLAVMEKNPHTADAQQLAALIVAKLRAAR
Download sequence
Identical sequences G1QHR7
XP_003272702.1.23891 ENSNLEP00000000454 ENSNLEP00000000454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]