SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000457 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000457
Domain Number 1 Region: 576-717,769-941
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.08e-80
Family Protein kinases, catalytic subunit 0.0000000000264
Further Details:      
 
Domain Number 2 Region: 256-333
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000676
Family V set domains (antibody variable domain-like) 0.074
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000000457
Domain Number - Region: 80-159
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00113
Family I set domains 0.033
Further Details:      
 
Domain Number - Region: 358-460
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0344
Family I set domains 0.042
Further Details:      
 
Domain Number - Region: 485-571
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0577
Family Rhodopsin-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000457   Gene: ENSNLEG00000000372   Transcript: ENSNLET00000000486
Sequence length 993
Comment pep:known_by_projection supercontig:Nleu1.0:GL397329.1:1009172:1110092:-1 gene:ENSNLEG00000000372 transcript:ENSNLET00000000486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALARGGGRLPLLVVFSAVIFGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESP
EDLGCALRPQSAGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDL
QNRGVVSMIILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQD
ALVCISESVPEPIVEWVLCDSQGESCKEESPAVVKKEEKVLRELFGTDIRCCARNELGRE
CTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGNYFEM
STYSTNRTMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFINATNSSEDYE
IDQYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDDGYSISKFCNHKHQPGEYIFHA
ENDDAQFTKMFTLNIRRKPQVLAEASASQASCSSDGYPLPSWTWKKCSDKSPNCTEEITE
GVWNRKANRKVFGQWVSSSTLNMSEAIKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQD
NISFYATIGVCLLFIVVLTLLICHKYKKQFRYESQLQMIQVTGSSDNEYFYVDFREYEYD
LKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMS
ELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKE
HNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDL
NVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDS
NYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYK
LIRNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDG
RVSERPHTYQNRPPFGRETDSGPLSPQAQVEDS
Download sequence
Identical sequences G1QHS0
ENSNLEP00000000457 XP_004088970.1.23891 ENSNLEP00000000457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]