SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000461 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000461
Domain Number 1 Region: 405-456
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000418
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000461   Gene: ENSNLEG00000000392   Transcript: ENSNLET00000000491
Sequence length 462
Comment pep:known_by_projection supercontig:Nleu1.0:GL397354.1:4795267:4811797:1 gene:ENSNLEG00000000392 transcript:ENSNLET00000000491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XALRFGFTAHDPSLMSAQDIPKYACPDLVTRPGYWAKALPENLALRDTVLAYWADRHGRV
FYSVNDGEPVLFHCGVAVGGPLWALIDVYGITDEVQLLGSGAFARGLESCGAILAHCNLC
LPGSSYSASAFRGTHFASGETEVTARIGQGASGKARGQWPTDLVASIFLQHPRSAPSPAT
VLSLCPPSLRAVPGPSRAPAVPPAFLATPRPACPPYVESPRRPLRPGESLFVEGRPGLAA
PGALAFGITSCDPGGLRPNELPADPDALLDRKEYWVVARAGPVPSGGDALSFTLRPGGDV
LLGVNGRPRGRLLCVDTTQALWAFFAVRGGVAGQLRLLGDTLQSSPATTTPSGSLSGSQD
DSDSDMTFSVNQSSSASESSLVTAPSSPLSPPVSPVFSPPEPAGIKNGECTVCFDGEVDT
VIYTCGHMCLCHSCGLRLKRQARACCPICRRPIKDVIKIYRP
Download sequence
Identical sequences ENSNLEP00000000461 ENSNLEP00000000461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]