SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000477 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000477
Domain Number 1 Region: 315-482
Classification Level Classification E-value
Superfamily L domain-like 1.05e-52
Family L domain 0.0000000856
Further Details:      
 
Domain Number 2 Region: 970-1221
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.73e-48
Family Protein kinases, catalytic subunit 0.00000000877
Further Details:      
 
Domain Number 3 Region: 16-176
Classification Level Classification E-value
Superfamily L domain-like 1.64e-43
Family L domain 0.0000001
Further Details:      
 
Domain Number 4 Region: 776-918
Classification Level Classification E-value
Superfamily Fibronectin type III 3.66e-24
Family Fibronectin type III 0.00000222
Further Details:      
 
Domain Number 5 Region: 511-598
Classification Level Classification E-value
Superfamily Fibronectin type III 1.58e-21
Family Fibronectin type III 0.00000321
Further Details:      
 
Domain Number 6 Region: 602-674,782-806
Classification Level Classification E-value
Superfamily Fibronectin type III 3.11e-18
Family Fibronectin type III 0.0000213
Further Details:      
 
Domain Number 7 Region: 161-317
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000173
Family Growth factor receptor domain 0.0000000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000477   Gene: ENSNLEG00000000403   Transcript: ENSNLET00000000512
Sequence length 1313
Comment pep:known_by_projection supercontig:Nleu1.0:GL397622.1:73536:225268:-1 gene:ENSNLEG00000000403 transcript:ENSNLET00000000512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLTCLASCSFSLLVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSF
PKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMN
ITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPA
TVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECLGNCSEPDDPTKCVACRNF
YLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSG
YTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLA
AELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQL
WDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCKSL
VPNLFGMRDWFKMVFPWTVIFSCDIRLVTAFLFCLESPYQNVTEFDGQDACGSNSWTVVD
IDPPLRSTDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDAT
NPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCLKGKQP
SLTVSPCRNTHTLHSISYENTRGQSQGALTRTRVASKCQPSGLSNEVPSVLKGVGFIRKT
SSGTGAEDPRPSRKRRSLGDVGNVTAAVPTVAAFPNTSSTSVPTSPEEHRPFEKVVNKES
LVISGLRHFTGYRIELQACNQDTPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNV
VHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCRLRGLSPGNYSVRVR
ATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDG
PLGPLYASSNPEYLSASDVFPCSVYVPDEWEVPREKITLLRELGQGSFGMVYEGNARDII
KGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVPPSLPHEYPQNPFLLDLATT
QVSADMGQVNPLGLCERLRACEPFVLSDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLK
DGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLM
RMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPL
DRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS
Download sequence
Identical sequences ENSNLEP00000000477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]