SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000506 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000506
Domain Number 1 Region: 26-500
Classification Level Classification E-value
Superfamily Sema domain 8.5e-172
Family Sema domain 0.0000000000000149
Further Details:      
 
Domain Number 2 Region: 502-552
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000484
Family Plexin repeat 0.0000461
Further Details:      
 
Domain Number 3 Region: 563-650
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000045
Family I set domains 0.0000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000506   Gene: ENSNLEG00000000397   Transcript: ENSNLET00000000541
Sequence length 862
Comment pep:known_by_projection supercontig:Nleu1.0:GL397590.1:4730:82692:-1 gene:ENSNLEG00000000397 transcript:ENSNLET00000000541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMCTPIRGLLMALAVMFGTAMAFAPIPRITWEHREVRLVQFHEPDIYNYSALLLSEDKD
TLYIGAREAVFAVNALNISEKQHEVYWKVSEDKKAKCAEKGKSKQTECLNYIRVLQPLSA
TSLYVCGTNAFQPACDHLNLTSFKFLGKNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYN
FLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFADVIRKSQDSSDSEDDRVYFFFTEVSV
EYEFVFRVLIPRIARVCKGDQGGLRTLQKKWTSFLKARLICSRPDSGLVFNVLRDVFVLR
SPGLKVPVFYAVFTPQLNNVGLSAVCAYNLSTAEEVFSHGKYMQSATVEQSHTKWVRYNG
PVPKPRPGACIDNEARAANYTSSLNLPDKTLQFVKDHPLMDDSVTPIDNRPRLIKKDVNY
TQIVVDRTQALDGTVYDVMFVSTDRGALHKAISLEHAVHIIEETQLFQDFEPVQTLLLSS
KKGKRFVYAGSNSGVVQAPLAFCGKHGTCEDCVLARDPYCAWSPLTATCVALHQTESPSR
GLIQEMSGDASVCPDKSKGSYRQHFFKHGGTAELKCSQKSNLARVFWKFQNGVLKAESPK
YGLMGRKNLLIFNLSEGDSGVYQCLSEERVKNKTVFQVVAKHVLEVKVVPKPVVAPTLSV
VQTEGSRIATKVLVASTQGSSPPTPAVQATSSGAITLPPKPAPTGTSCEPKIVINTVPQL
HSEKTMYLKSSDNRLLMSLFLFFFVLFLCLFFYNCYKGYLPRQCLKFRSALLIGKKKPKS
DFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLS
ARDKPFDVKCELKFADSDADGD
Download sequence
Identical sequences G1QHW6
ENSNLEP00000000506 ENSNLEP00000000506 XP_012356185.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]