SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000509 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000509
Domain Number 1 Region: 226-254,600-874
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000714
Family Rhodopsin-like 0.028
Further Details:      
 
Domain Number 2 Region: 124-251
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000204
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 261-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000028
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 4 Region: 72-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000136
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 32-67
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000154
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000509   Gene: ENSNLEG00000000380   Transcript: ENSNLET00000000544
Sequence length 888
Comment pep:known_by_projection supercontig:Nleu1.0:GL397610.1:175176:227124:1 gene:ENSNLEG00000000380 transcript:ENSNLET00000000544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGFNLLLFWGECEAEWGASLSKLFFIHCLGNNCRDSTMCPAYATCTNTVDSYYCTCKQG
FLSSNGQNHFKGPGVQCKDIDECSQSPQPCGPNSSCKNLSGRFKCSCLDGFSSPTGNNWV
PGKPGNFSCTDINECLTGRVCPEHSDCVNSMGSYNCSCQVGFISRNSICEDVDECADPRA
CPEHATCNNTVGNYSCFCNPGFESSSGHLSFQGLKASCEDIDECTEMCPINSTCTNTPGS
YFCTCHPGFAPSNGQLNFTDQEVECRDIDECRQDPSTCGPNSICTNALGSYNCGCIAGFH
PNPEGSQNDGNFSCQRVLFKCKEDVISDNEQVQQCQEGTAVKPAYVSFCAQINNILSILD
KVCENKTTVVSLKNTAESFVPVLKQISTWTKFTKEETSSLATVFLESVESMTLASFWKPS
ANVTLAVRTEYLDIESKVINKECSEENVTLNLVAKGDKMKIGCSTIEESESTGTTGVAFV
SFVGMESVLNERFFQDHQAPLTTSEIKLKMNSRVTGGIMTGEKKDGFSDPVIYTLENIQP
KQKFERPICVSWSTDVEGGRWTSFGCVILEASETYTVCSCNRMANLAVIMASGELTMDFS
LYVISHVGIIISLVCLVLAIATFLLCRSIRNHNTYLHLHLCVCLLLAKTVFLADVHASPL
QTGCAIIAGFLHYLFLACFFWMLVEAVILFLMVRNLKVVNYFSSRNIKMLHICAFGYGLP
VLLVVISASVQPQGYGMHNRCWLNTETGFIWSFLGPVCAVIVTLQINSILLTWTLWILRQ
RLSSVNAEVSTLKDTRLLTFKAFAQLFILGCSWVLGIFQIGPVAGVMAYLFTIINSLQGA
FIFLIHCLLNHQVREEYKRWTIGKTKPSSQSQTSRILLSSMPSTSKMG
Download sequence
Identical sequences ENSNLEP00000000509 ENSNLEP00000000509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]