SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000516 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000516
Domain Number 1 Region: 499-737
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000131
Family Protein kinases, catalytic subunit 0.01
Further Details:      
 
Domain Number 2 Region: 44-71
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000235
Family CCCH zinc finger 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000516   Gene: ENSNLEG00000000388   Transcript: ENSNLET00000000552
Sequence length 887
Comment pep:known_by_projection supercontig:Nleu1.0:GL397329.1:1141990:1297569:1 gene:ENSNLEG00000000388 transcript:ENSNLET00000000552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSGGGLPPPTAAASPSSSSLAAAVAVVAPPGVGGVPGGAAVGVKLKYCRYYAKDKTCFY
GEECQFLHEDPAAGAAPGLGLHSNSVPPSLVGAPVAGFSPRAVAGGGNRTPPGPKKPDLG
DPGTGAAAGGGGSSGGLDGPRLAIPGMDGGALTDTSLTDSYFSTSFIGVNGFGSPVDTKY
PLMQRITNSSSSPSLLNDSAKPYSGHDPLTSPASSLFNDFGALNISQRRKTRKYRLGMLE
ERLVPMGSKARKAKNPIGCLADRCKSGVPINMVWWNRVTENNLQTPNPTASEFIPKGGST
SRLSNVSQSNMSAFSQVFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRR
SHTPNPASYMVPSSASTSVNNPVSQTPSSGQVIQKETVGGTTYFYTDTTPAPLTGMVFPN
YHIYPPTAPHVAYMQPKANAPSFFMADELRQELINRHLITMAQIDQADMPAVPTEVDSYH
SLFPLEPLPPPNRIQKSSNFGYITSCYKAVNSKDDLPYCLRRIHGFRLVNTKCMVLVDMW
KKIQHSNIVTLREVFTTKAFAEPSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWGQH
DGPLPRQHAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKILITGKTRLRVNCVG
VFDVLTFDNSQNNNPLALMAQYQQADLISLGKVVLALACNSLAGIQRENLQKAMELVTIN
YSSDLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRL
FRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLN
KLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAANGQL
Download sequence
Identical sequences A0A2I3HWC7
ENSNLEP00000000516 ENSNLEP00000000516 XP_003270264.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]