SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000527 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000527
Domain Number 1 Region: 8-167
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-43
Family Dual specificity phosphatase-like 0.000000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000527   Gene: ENSNLEG00000000440   Transcript: ENSNLET00000000563
Sequence length 173
Comment pep:known_by_projection supercontig:Nleu1.0:GL397384.1:1940430:1949531:1 gene:ENSNLEG00000000440 transcript:ENSNLET00000000563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTALVEK
EGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALI
EGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ
Download sequence
Identical sequences A0A2I3GRY3 A0A2K6F4L2 H2PJH1
ENSPPYP00000018734 ENSPPYP00000018734 ENSETEP00000006648 ENSNLEP00000000527 XP_003276039.1.23891 XP_004696385.1.18182 XP_007955114.1.48129 XP_012358293.1.23891 XP_012358294.1.23891 XP_012505733.1.63892 XP_021505510.1.76796 ENSNLEP00000000527 ENSETEP00000006648 9600.ENSPPYP00000018734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]