SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000538 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000538
Domain Number 1 Region: 1412-1698
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.88e-82
Family Protein kinases, catalytic subunit 0.000000129
Further Details:      
 
Domain Number 2 Region: 623-715
Classification Level Classification E-value
Superfamily Immunoglobulin 8.36e-27
Family I set domains 0.0038
Further Details:      
 
Domain Number 3 Region: 1285-1400
Classification Level Classification E-value
Superfamily Fibronectin type III 4.97e-25
Family Fibronectin type III 0.00059
Further Details:      
 
Domain Number 4 Region: 1776-1868
Classification Level Classification E-value
Superfamily Immunoglobulin 6.17e-25
Family I set domains 0.0000116
Further Details:      
 
Domain Number 5 Region: 511-603
Classification Level Classification E-value
Superfamily Immunoglobulin 4.33e-24
Family I set domains 0.0073
Further Details:      
 
Domain Number 6 Region: 159-252
Classification Level Classification E-value
Superfamily Immunoglobulin 7.23e-24
Family I set domains 0.0076
Further Details:      
 
Domain Number 7 Region: 1067-1158
Classification Level Classification E-value
Superfamily Immunoglobulin 2.1e-23
Family I set domains 0.026
Further Details:      
 
Domain Number 8 Region: 32-125
Classification Level Classification E-value
Superfamily Immunoglobulin 1.11e-22
Family I set domains 0.0042
Further Details:      
 
Domain Number 9 Region: 414-506
Classification Level Classification E-value
Superfamily Immunoglobulin 1.92e-22
Family I set domains 0.0082
Further Details:      
 
Domain Number 10 Region: 1205-1302
Classification Level Classification E-value
Superfamily Immunoglobulin 3.03e-19
Family I set domains 0.00000326
Further Details:      
 
Domain Number 11 Region: 721-797
Classification Level Classification E-value
Superfamily Immunoglobulin 3.08e-16
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000538   Gene: ENSNLEG00000000375   Transcript: ENSNLET00000000574
Sequence length 1881
Comment pep:known_by_projection supercontig:Nleu1.0:GL397380.1:2026154:2223606:-1 gene:ENSNLEG00000000375 transcript:ENSNLET00000000574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDVKLVASSHISKTSLSVDPSRVNSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYP
EPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE
LTVEGDFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRF
SCKITGRPQPQVTWLKGNVPLQPSARVSMSEKNGMQVLEIHGVNQDDMGVYTCLVVNGSG
KASMSAELSIQGIDQSCLSFGRETKATNSDVRKEVTNVSSKESKLDSLEAAAESKNCSSP
QRGGSPPWAANSQPQPPRESKLESCKDSPRTPPQIPVLQKTSSSITLQAARVQLEPRAPG
LGVLSPSGEERKRPAAPRPATFPTRQPGLGSQDVVSKAATRRIPMEDQRDSAFPKFESKP
QSQEVGENQTVKFRCEVSGIPKPEVAWFLEGTPVRRQEGSIEVYEDAGSHYLCLLKARTR
DSGTYSCTASNAQGQVSCSWTLQVERLAVMEVAPCFSSVLKDCTVIEGQDFVLQCSVRGT
PVPQITWLLNGQPIQYAHSTCEAGMAELHIQDALPEDHGTYTCLAENALGQVSCSARVTV
REKKSSGKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNG
NEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQ
PWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLV
LKKVQPWHAGQYEILLNTNRFSASLPFLALVYCTKRGNDKKVSLCRPGWSAENTCWVFNT
KSSDLRALSMRKGTTSTLRDHGVRVKVTGQAHHQGLSRPSCSITVPSRVSLSPSPFIAGN
FHLPRWPAACVTDATEQLCQSPSTVSASSSCSTRPCPHPHLPPGPGSSSPAALDWRAWKG
NEGGRAGEGGAPLTNVPIYKHSLASLPAPLPLPSTLPPSGICSPLTFLSYPAPFPPATFL
FPFTGCKGREPASCEGLWQDVKNDVTQRGHVGTTDNERSESRGTAPFKEKLQDVRVAEGK
KLLLQCQVSSDPPATITWTLNGKTLKTTKFIVLSQEGSLCSISIEKALPEDRGLYKCVAK
NDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPK
AAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGS
KLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWY
GSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTS
EPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTVNTEQKVSDFYDIEERLGSG
KFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKAN
IVMVLEIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMC
VNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVICYI
LVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDCTQC
LQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSS
TGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIE
GYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATC
TAELIVETMEEGEGEGEEEEE
Download sequence
Identical sequences ENSNLEP00000000538 ENSNLEP00000000538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]