SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000553 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000553
Domain Number 1 Region: 180-252
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000737
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 242-302
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000031
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 56-112
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000834
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 4 Region: 117-178
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000132
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000553   Gene: ENSNLEG00000000441   Transcript: ENSNLET00000000591
Sequence length 490
Comment pep:known_by_projection supercontig:Nleu1.0:GL397575.1:148977:305965:-1 gene:ENSNLEG00000000441 transcript:ENSNLET00000000591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYHGMNPSSGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGGFDDLQMCADP
GIPENGFRTPSGGVFFEGSVARFHCQDGFKLKGATKRLCLKHFNGTLGWIPSDSSICVQE
DCRIPQIEDAEIHNKTYRHGEKLIITCHEGFKIRYPDLHNMVSLCRDDGTWNNLPICQGC
LRPLASSNGYVNISEFQTSFPVGTVISYRCFPGFKLDGSAYLECLHNLIWSSSPPRCLAL
EVCPLPPMVSHGDFVCHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSYQV
YCIKSEQTWPSTHETLLTTWKIVAFTATSVLLVLLLVILARMFQTKFKAHFPPRGPPRSS
SSDPDFVVVDGVPVMLPSYDEAVSGGLSALGPGYMASVGQGCPLPVDDQSPPAYPGSGDT
DTGPGESETCDSVSGSSELLQSLYSPPRCQESTHPASDNPDTIASTAEEVASTSPGIDIA
DEIPLMEEDP
Download sequence
Identical sequences G1QI11
ENSNLEP00000000553 XP_003281819.1.23891 XP_012361904.1.23891 ENSNLEP00000000553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]