SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000577 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000577
Domain Number 1 Region: 19-121
Classification Level Classification E-value
Superfamily Immunoglobulin 1.2e-25
Family V set domains (antibody variable domain-like) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000577   Gene: ENSNLEG00000000498   Transcript: ENSNLET00000000615
Sequence length 123
Comment pep:known_by_projection supercontig:Nleu1.0:GL397571.1:88552:90229:-1 gene:ENSNLEG00000000498 transcript:ENSNLET00000000615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACRCLSFLLMGTFLSVSQTVLAQLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQR
AGSAPRYLLYYRSEEDHHRPTDIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYG
FGP
Download sequence
Identical sequences G1QI34
ENSNLEP00000000577 ENSNLEP00000000577 XP_003281772.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]