SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000603 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000603
Domain Number 1 Region: 342-397
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000536
Family TSP-1 type 1 repeat 0.00036
Further Details:      
 
Domain Number 2 Region: 397-452
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000314
Family TSP-1 type 1 repeat 0.00052
Further Details:      
 
Domain Number 3 Region: 294-337
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000085
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 4 Region: 452-507
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000366
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000000603
Domain Number - Region: 880-1066,1095-1176
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00568
Family Rhodopsin-like 0.028
Further Details:      
 
Domain Number - Region: 43-126
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00611
Family Spermadhesin, CUB domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000603   Gene: ENSNLEG00000000505   Transcript: ENSNLET00000000643
Sequence length 1522
Comment pep:known_by_projection supercontig:Nleu1.0:GL397334.1:2234869:3003666:1 gene:ENSNLEG00000000505 transcript:ENSNLET00000000643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAVRNLLIYIFSTYLLVMFGFNAAQDFWCSTLVKGVIYGSYSVSEMFPKNFTNCTWTLE
NPDPTKYSIYLKFSKKDLSCSNFSLLAYQFDHFSHEKIKDLLRKNHSIMQLCNSKNAFVF
LQYDKNFIQIRRVFPTDFPGLQKKRQEDQKSFFEFLVLNKVSPSQFGCHVLCTWLESCLK
SENGRTESCGIMYTKCTCPQHLGEWGIDDQSLVLLNNVVLPLNEQTEGCLTQELQTTQVC
NLTREANFILSLEFGMMGDHTIKSQRPRSVHEKRVPQEQADAAKFMAQTGESGVEEWSQW
STCSVTCGQGSQVRTRTCVSPYGTHCSGPLRESRVCNNTALCPVHGVWEEWSPWSLCSFT
CGRGQRTRTRSCTPPQYGGRPCEGPETHHKPCNIALCPVDGQWQEWSSWSQCSVTCSNGT
QQRSRQCTAAAHGGSECRGPWAESRECYNPECTANGQWNQWGHWSGCSKSCDGGWERRIR
TCQGAVITGQQCEGTGEEVRRCSEQRCPAPYEICPEDYLMSMVWKRTPAGDLAFNQCPLN
ATGTTSRRCSLSLHGVAFWEQPSFARCISNEYRHLQHSVKEHLAKGQRMLAGDGMSQVTK
TLLDLTQRKNFYAGDLLMSVEILRNVTDTFKRASYIPASDGVQNFFQIVSNLLDEENKEK
WEDAQQIYPGSIELMQVIEDFIHIVGMGMMDFQNSYLMTGNVVASIQKLPAASVLTDINF
PMKGRKGMVDWARNSEDRVVIPKSIFTPVSSKELDESSVFVLGAVLYKNLDLILPTLRNY
TVINSKIIVVTIRPEPKTTDSFLEIELAHLANGTLNPYCVLWDDSKTNESLGTWSTQGCK
TVLTDASHTKCLCDRLSTFAILAQQPREIIMESSGTPSVTLIVGSGLSCLALITLAVVYA
ALWRYIRSERSIILINFCLSIISSNILILVGQTQTHNKSICTTTTAFLHFFFLASFCWVL
TEAWQSYMAVTGKIRTRLIRKRFLCLGWGLPALVVATSVGFTRTKGYGTDHYCWLSLEGG
LLYAFVGPAAAVVLVNMVIGILVFNKLVSRDGILDKKLKHRAGQMSEPHSGLTLKCAKCG
VVSTTALSATTASNAMASLWSSCVVLPLLALTWMSAVLAMTDKRSILFQILFAVFDSLQG
FVIVMVHCILRREVQDAFRCRLRNCQDPINADSSSSFPNGHAQIMTDFEKDVDIACRSVL
HKDIGPCRAATITGTLSRISLNDDEEEKGTNPEGLSYSTLPGNVISKVIIQQPTGLHMPM
SMNELSNPCLKKENSELRRTVYLCTDDNLRGADMDIVHPQERMMESDYIVMPRSSVNNQP
SMKEESKMNIGMETLPHERLLHYKVNPEFNMNPPVMDQFNMNLEQHLAPQEHMQNLPFEP
RTAVKNFMASELDDNAGLSRSETGSTISMSSLERRKSRYSDLDFEKVMHTRKRHMELFQE
LNQKFQTLDRFRDIPNTSSMENPAPNKNPWDTFKNPSEYPHYTTINVLDTEAKDALELRP
AEWEKCLNLPLDVQEGDFQTEV
Download sequence
Identical sequences ENSNLEP00000000603 ENSNLEP00000000603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]