SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000606 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000606
Domain Number 1 Region: 156-489
Classification Level Classification E-value
Superfamily Subtilisin-like 3.14e-93
Family Subtilases 0.000000000842
Further Details:      
 
Domain Number 2 Region: 485-635
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.28e-41
Family Proprotein convertase P-domain 0.00018
Further Details:      
 
Domain Number 3 Region: 691-853
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.19e-34
Family Growth factor receptor domain 0.00028
Further Details:      
 
Domain Number 4 Region: 70-139
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000000272
Family Prohormone convertase 1 pro-domain 0.0078
Further Details:      
 
Domain Number 5 Region: 843-886
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000785
Family Growth factor receptor domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000606   Gene: ENSNLEG00000000500   Transcript: ENSNLET00000000646
Sequence length 972
Comment pep:known_by_projection supercontig:Nleu1.0:GL397555.1:228206:414109:-1 gene:ENSNLEG00000000500 transcript:ENSNLET00000000646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPLPRVDGREPAPWSPATVREALGQRRAGGPGFKTSPGAEGGWPPPGSWDWVLALPLTRS
PGLAPPSHVHWRAEWAGGPLELFDVIWGRFGVLLILQIGNLEDYYHFYHSKTFKRSTLSS
RGPHTFLRMDPQVKWLQQQEVKRRVKRQVRSDPQALYFNDPIWSNMWYLHCGDKNSRCRS
EMNVQAAWKRGYTGKNVVVTILDDGIERNHPDLAPNYDSYASYDVNGNDYDPSPRYDASN
ENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRMLDGDVTDVVEAKSLGIRPNYIDIY
SASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGREGDYCSCDGYTN
SIYTISVSSATENGYKPWYLEECASTLATTYSSGAFYERKIVTTDLRQRCTDGHTGTSVS
APMVAGIIALALEANSQLTWRDVQHLLVKTSRPAHLKASDWKVNGAGHKVSHFYGFGLVD
AEALVVEAKKWTAVPSQHMCVAASDKRPRSIPLVQVLRTTALTSACAEHSDQRVVYLEHV
VVRISISHPRRGDLQIYLISPSGTKSQLLAKRLLDLSNEGFTNWEFMTVHCWGEKAEGQW
TLEIQDLPSQVRNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSRMLELSAPGLEPPKA
ALSPSQVEVPEDEEDYTAHSTPGSANILQTSVCHPECGEKGCDGPNADQCLNCVHFSLGS
VKTSRKCVSVCPLGYFGDTTARRCRRCHKGCETCTGRGVTQCLSCRRGFYHHQEMNTCVT
LCPAGFYADESQKNCLKCHPSCKKCVDEPEKCTVCKEGFSLARGSCIPDCEPGTYFDSEL
VRCGECHHTCGTCVGPGREECIHCAKNFHFQDWKCVPACGEGFYPEEMPGLPHKVCRRYG
LPGGERQAAVSSRGVAGGQSLAASSPGAGEGMLHHPTVDRSPFTELVRGLCPFVHIHICW
VPAVGQTLCSNG
Download sequence
Identical sequences ENSNLEP00000000606 ENSNLEP00000000606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]