SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000615 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000615
Domain Number 1 Region: 146-231
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000783
Family I set domains 0.032
Further Details:      
 
Domain Number 2 Region: 23-136
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000079
Family V set domains (antibody variable domain-like) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000615   Gene: ENSNLEG00000000465   Transcript: ENSNLET00000000653
Sequence length 409
Comment pep:known_by_projection supercontig:Nleu1.0:GL397348.1:3692342:3710418:-1 gene:ENSNLEG00000000465 transcript:ENSNLET00000000653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGILLGLLLLGHLTVDTYGHPILEVPESITGPWKGDVNIPCTYDPLQGYTQVLMKWLVQH
GSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTP
DGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKE
QSNNQEPIKVATLSTLLFKPAVVADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTK
TEAPTTMRYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPVFAIILIISLCCMVVFT
MAYIILCRKTSQEGHVYEAARAHGREANDSGETMRVAIFASGCSSDEPTSQNLGNNYSDE
PCIGQEYQIIAQINGDYAHLLDTVPPDYEFPATEGKSVKNAPLGQDLLT
Download sequence
Identical sequences ENSNLEP00000000615 XP_003272709.2.23891 ENSNLEP00000000615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]