SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000630 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000630
Domain Number 1 Region: 21-286
Classification Level Classification E-value
Superfamily L domain-like 1.02e-42
Family Ngr ectodomain-like 0.0066
Further Details:      
 
Domain Number 2 Region: 284-376
Classification Level Classification E-value
Superfamily Immunoglobulin 3.28e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 419-497
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000116
Family Fibronectin type III 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000630   Gene: ENSNLEG00000000542   Transcript: ENSNLET00000000673
Sequence length 789
Comment pep:known_by_projection supercontig:Nleu1.0:GL397547.1:507129:703412:-1 gene:ENSNLEG00000000542 transcript:ENSNLET00000000673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLLGGLLAFGMAFAVVDACPKYCVCQNLSESLGTLCPSKGLLFVPPDIDRRTVELRLG
GNFIIHISRQDFANMTGLVDLTLSRNTISHIQPFSFLDLESLRSLHLDSNRLPSLGEDTL
RGLVNLQHLIVNNNQLGGIADEAFEDFLLTLEDLDLSYNNLHGLPWDSVRRMVNLHQLSL
DHNLLDHIAEGTFADLQKLARLDLTSNRLQKLPPDPIFARSQASALTATPFAPPLSFSFG
GNPLHCNCELLWLRRLERDDDLETCGSPGGLKGRYFWHVREEEFVCEPPLITQHTHKLLV
LEGQAATLKCKAIGDPSPLIHWVAPDDRLVGNSSRTAVYDNGTLDIFITTSQDSGAFTCI
AANAAGEATATVEVSIVQLPHLSNSTSRTAPPKSRLSDITGSSKTSRGGGGSGGGEPPKS
PPERAVLVSEVTTTSALVKWSVSKSAPRVKMYQLQYNCSDDEVLIYRMIPASNKAFVVNN
LVSGTGYDLCVLAMWDDTATTLTATNIVGCAQFFTKADYPQCQSMHSQILGGTMILVIGG
IIVATLLVFIVILMVRYKVCSHEAPSKMAAAVSNVYSQTNGAQPPPPSSAPTGAPPQGPP
KVVVRNELLDFTASLARASDSSSSSSLGSGEAAGLGRAPWRLPPSAPRPKPSLDRLMGAF
ASLDLKSQRKEELLDSRTPAGRGAGTSARGHHSDREPLLGPPAARARSLLPLPLEGKAKR
SHSFDMGDFAAAAAGGVVPGGYSPPRRVSNIWTKRSLSVNGMLLPFEESDLVGARGTFGS
SEWVMESTV
Download sequence
Identical sequences G1QI87
ENSNLEP00000000630 XP_003281543.1.23891 ENSNLEP00000000630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]