SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000632 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000632
Domain Number 1 Region: 159-422
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.13e-37
Family Eukaryotic proteases 0.00034
Further Details:      
 
Domain Number 2 Region: 65-126
Classification Level Classification E-value
Superfamily GLA-domain 2.94e-22
Family GLA-domain 0.00053
Further Details:      
 
Domain Number 3 Region: 115-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000154
Family EGF-type module 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000632   Gene: ENSNLEG00000000525   Transcript: ENSNLET00000000675
Sequence length 422
Comment pep:known_by_projection supercontig:Nleu1.0:GL397472.1:1258162:1273683:1 gene:ENSNLEG00000000525 transcript:ENSNLET00000000675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGCFLLLQGLVLVLALHRAEPSGRHLAYLSVVPALFICLLVSSVVFLPATKANDVLVRW
MRAGSYLLEELFEGNLEKECYEEICVYEEAREVFENEVVTDEFWRRYKGGSPCISQPCLH
NGSCQDSIWGYTCTCSPGYEGSNCELAKNECHPERIDGCQHFCLPGQESYTCSCAQGYRL
GEDHKQCVPHDQCACGVLTSEKCAPDLQDLPWQVKLTNSEGKDFCGAVIIQENFVLTTAK
CSLLHRNISVKTHFNRTSQDPLMIKITHVHVHMRYDADTGENDLSLLELEWPIQCPGAGL
PVCTPEKDFAEHLLIPRTRGLLSGWARNGTDLGNSLTMLPVTLVEGEECGQVLNVTVTTR
TYCERSSMAAMHWMEGSVVTREHGGSWFLTGVLGSQPAGEQTRMVLVTKVSRYSLWFKQI
MN
Download sequence
Identical sequences ENSNLEP00000000632 ENSNLEP00000000632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]