SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000655 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000655
Domain Number 1 Region: 807-935,980-1153
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.66e-79
Family Protein kinases, catalytic subunit 0.00000000172
Further Details:      
 
Domain Number 2 Region: 660-750
Classification Level Classification E-value
Superfamily Immunoglobulin 1.78e-22
Family I set domains 0.0069
Further Details:      
 
Domain Number 3 Region: 124-222
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000251
Family I set domains 0.0000133
Further Details:      
 
Domain Number 4 Region: 568-642
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000691
Family V set domains (antibody variable domain-like) 0.04
Further Details:      
 
Domain Number 5 Region: 234-331
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000746
Family I set domains 0.038
Further Details:      
 
Domain Number 6 Region: 351-431
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000313
Family I set domains 0.035
Further Details:      
 
Domain Number 7 Region: 421-468,506-553
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000123
Family I set domains 0.052
Further Details:      
 
Domain Number 8 Region: 36-109
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000861
Family V set domains (antibody variable domain-like) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000655   Gene: ENSNLEG00000000456   Transcript: ENSNLET00000000698
Sequence length 1338
Comment pep:known_by_projection supercontig:Nleu1.0:GL397329.1:1304597:1500235:-1 gene:ENSNLEG00000000456 transcript:ENSNLET00000000698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSCWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHVMQAGQTLRLQCRGEAAHK
WSLPETVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKET
ESAIYIFISDTGRPFIEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLETLIPD
GKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPV
KLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRQRIDQSNSHANIFYSVLTIDK
VQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQRVLETVAGKRSYRLSMKVK
AFPSPEVVWLKDGLPTTEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSDVFKNLTA
TLIVNVQPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWHPCNHNHSEARC
DFCSNNEDSFILDPDSNTGNRIDSITQRMAIIEGKNKTASTLVVADSRISGIYICIASNK
VGTVARNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTM
HYSISKQKMAITKEHSITLNLTIMNVSMEDSGTYACRARNVYTGEEILQKKEITIRDQEA
PYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHKIQQEPGIILGPGSSTLFIER
VTEEDEGVYHCKATNQKGSVESSAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLTLFI
RKMKRSSSEIKTDYLSIIMDPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFGK
VVQASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACTK
QGGPLMVIVEYCKYGNLSNYLKSKRDLFFLNKDAALHMEPKKEKMEPGLEQGKKPRLDSV
TSSESFASSGFQEDKSLSDVEEEEDSDGFYKEPITMEDLISYSFQVARGMEFLSSRKCIH
RDLAARNILLSENNVVKICDFGLARDIYKNPDYVRKGDTRLPLKWMAPESIFDKIYSTKS
DVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLREGMRMRAPEYSTPEIYQIMLDCWHRD
PKERPRFAELVEKLGDLLQANVQQDGKDYIPINAILTGNSGFTYSTPAFSEDFFKEGISA
PKFNSGSSDDVRYVNAFKFMSLERIKTFEELLPNATSMFDDYQGDSSTLLASPMLKRFTW
TDSKPKASLKIDLRVTSKSKESGLSDVSRPSFCHSSCGHISDGKRRFTYDNAELERKIAC
CSPPPDYNSVVLYSTPPI
Download sequence
Identical sequences G1QIB2
ENSNLEP00000000655 XP_003270266.1.23891 ENSNLEP00000000655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]