SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000683 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000683
Domain Number 1 Region: 112-170
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.00000000675
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000683   Gene: ENSNLEG00000000588   Transcript: ENSNLET00000000729
Sequence length 184
Comment pep:novel supercontig:Nleu1.0:GL397518.1:1047865:1118899:1 gene:ENSNLEG00000000588 transcript:ENSNLET00000000729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLCPLLLVGFSLPLARALRGNETTADSNETTTTSGPPDPGASQPLAWLLLPLLLLVLV
LLLAAYFFRFRKQRKAVVSASDKKMPNGILEEQEQQRVMLLSRSPSGPKKYFPIPVEHLE
EEIRIRSADDCKQFREEFNSLPSGHIQGTFELANKEENREKNRYPNILPSKILFYVLHDR
WCLH
Download sequence
Identical sequences ENSNLEP00000000683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]