SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000690 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000690
Domain Number 1 Region: 27-95
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000552
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000000690
Domain Number - Region: 147-190
Classification Level Classification E-value
Superfamily Nitrile hydratase alpha chain 0.0471
Family Nitrile hydratase alpha chain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000690   Gene: ENSNLEG00000000603   Transcript: ENSNLET00000000736
Sequence length 236
Comment pep:known_by_projection supercontig:Nleu1.0:GL397582.1:325570:335474:-1 gene:ENSNLEG00000000603 transcript:ENSNLET00000000736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMFRSLVASAQQRQPPAGPAGGDSGLEAQYTCPICLEVYHRPVAIGSCGHTFCGECLQP
ATGGSHRCAHSAAAFDPKKVDKATHVEKQLSSYKAPCRGCNKKVTLAKMRVHISSCLKVQ
EQMANCPKFVPVVPTSQPIPSNIPNRSTFACPYCGARNLDQQELVKHCVESHRSDPNRVV
CPICSAMPWGDPSYKSANFLQHLLHRHKFSYDTFVDYSIDEEAAFQAALALSLSEN
Download sequence
Identical sequences ENSNLEP00000000690 ENSNLEP00000000690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]