SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000767 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000767
Domain Number 1 Region: 722-1297
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 3.53e-185
Family Myeloperoxidase-like 0.00000000256
Further Details:      
 
Domain Number 2 Region: 34-238
Classification Level Classification E-value
Superfamily L domain-like 7.48e-42
Family Ngr ectodomain-like 0.002
Further Details:      
 
Domain Number 3 Region: 233-323
Classification Level Classification E-value
Superfamily Immunoglobulin 6.23e-23
Family I set domains 0.013
Further Details:      
 
Domain Number 4 Region: 329-423
Classification Level Classification E-value
Superfamily Immunoglobulin 1.14e-22
Family I set domains 0.0078
Further Details:      
 
Domain Number 5 Region: 512-599
Classification Level Classification E-value
Superfamily Immunoglobulin 2.22e-22
Family I set domains 0.0069
Further Details:      
 
Domain Number 6 Region: 415-506
Classification Level Classification E-value
Superfamily Immunoglobulin 9.42e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 7 Region: 1393-1452
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000167
Family VWC domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000767   Gene: ENSNLEG00000000611   Transcript: ENSNLET00000000814
Sequence length 1463
Comment pep:known_by_projection supercontig:Nleu1.0:GL397267.1:1477214:1967517:-1 gene:ENSNLEG00000000611 transcript:ENSNLET00000000814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESRLFCWTTLFVLAGWCLPGLPCPSRCLCFKSTVRCMHLMLDHIPQVPQQTTVLDLRFN
RIREIPGSAFKKLKNLNTLLLNNNHIRKISRNAFEGLENLLYLYLYKNEIHALDKQTFKG
LISLEHLYIHFNQLETLQPETFGDLLRLERLFLHNNKLSKIPAGSFSNLDSLKRLRLDSN
ALVCDCDLMWLGELLQGFAQHGHTQAAATCEYPRRLHGRAVASVTVEEFNCQSPRITFEP
QDVEVPSGNTVYFTCRAEGNPKPEIIWIHNNHSLDLEDDTRLNMFDDGTLMIRNTRESDQ
GVYQCMARNSAGEAKTQSAMLRYSSLPAKPSFVIQPQDTEVLIGTSTTLECMATGHPHPH
ITWTRDNGWELDGSRHVATSSGLYLQNITQRDHGRFTCHANNSHGSVQAAANIIVQAPPQ
FTVTPKDQVVLEEHAVEWLCEADGNPPPVIVWTKTGGQLPVEGQHMVLSSGTLRIDHAAQ
HDQGQYECQAVSSLGVKKVSVQLTVKPKALAVFTQLPQDTSVEVGKNINISCHAQGEPRP
IITWNKEGVQITESGKFHVDGEGTLTIYDAGFPDQGRYECVARNSFGLVVTNMFLTVTAI
QDRQAGDDFVESSILDAVQRVDSAINSTRRHLFSQKPHTSSDLLAQFHYPRDPLIVEMAR
AGEIFEHTLQLIRERVKQGLTVDLEGKEFRYNDLVSPRSLSLIANLSGCTARRPLPNCSD
PCFHAKYRAHDGTCNNLQQPTWGAALTAFARLLQPAYQDGIRAPRGLRLPVGSRQPLPPP
RLVATVWARAAAVTPDHSYTRMLMHWGWFLEHDLDHTVPALSTARFSDGRPCSSVCTNDP
PCFPMNTRHADPRGTHAPCMLFARSSPACASGRPSTTVDSVYAREQINQQTAYIDGSNIY
GSSERESQALRDPSVPRGLLRTGLPWPPSGKPLLPFSTGPPTECARQEQDSPCFLAGDHR
ANEHLALTAMHTLWFREHNRVATELSALNPHWEGNTVYQEARKIVGAELQHITYSHWLPK
VLGDPGTRMLRGYRGYNPNVNAGIINSFATAAFRFGHTLINPILYRLNATLGEISEGHLP
FHKALFSPSRIIKEGGIDPVLRGLFGVAAKWRTPSYLLSPELSQRLFSAAYSAAVDSAAT
VIQRGRDHGIPPYVDFRVFCNLTSVKNFEDLQNEIKDSEIRQKLRKLYGSPGDIDLWPAL
MVEDLIPGTRVGPTLMCLFVTQFQRLRDGDRFWYENPGVFTPAQLTQLKQASLGRVLCDN
GDSIQQVQADVFVKAEYPQDYLSCSEIPKVDLRVWQDCCADCRSRGQFRAVTQESQKKRS
AQYIYPDDKDMELSHLRNRQQDKIYVGEDARNVAVLAKTKFSQDFSTFAVEIQETITALR
KQINKLEGRLRQAGCTDVKGVPRKAEERWMKEDCTHCVCESGQVTCVVDICPPAPCPSPE
LVKGSCCPVCRDRGMPTDSPEKR
Download sequence
Identical sequences G1QIM4
XP_003255994.1.23891 ENSNLEP00000000767 ENSNLEP00000000767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]