SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000792 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000792
Domain Number 1 Region: 237-478
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 7.54e-58
Family Decarboxylase 0.000000458
Further Details:      
 
Domain Number 2 Region: 12-206
Classification Level Classification E-value
Superfamily PRTase-like 1.05e-44
Family Phosphoribosyltransferases (PRTases) 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000792   Gene: ENSNLEG00000000631   Transcript: ENSNLET00000000840
Sequence length 480
Comment pep:known_by_projection supercontig:Nleu1.0:GL397380.1:3180443:3194388:1 gene:ENSNLEG00000000631 transcript:ENSNLET00000000840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGAALGPLVTDLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQT
AQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCL
IIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIHLHSVCTLSKML
EILEQQKKIDAETVERVKRFIQDNVFVAANHNGSPLSIKEAPKELSVSARAELPRIHPVA
SKLLRLMQKKETNLCLSADVSEARELLQLADALGPSICMLKTHVDILNDFTLDVMKELIT
LAKRHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLP
LHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQ
LEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV
Download sequence
Identical sequences ENSNLEP00000000792 ENSNLEP00000000792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]