SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000810 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000810
Domain Number 1 Region: 10-82
Classification Level Classification E-value
Superfamily RING/U-box 3.76e-18
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 2 Region: 88-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.11e-16
Family B-box zinc-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000810   Gene: ENSNLEG00000000696   Transcript: ENSNLET00000000860
Sequence length 210
Comment pep:novel contig::ADFV01137293.1:13604:18400:-1 gene:ENSNLEG00000000696 transcript:ENSNLET00000000860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RNMNSGISQLFQREVTCPICMNYFIDPVTIDCGHSFCRPCFYLNWQDIPILTQCFECIKS
TQQRNLTTNIRLKKMASLARKASLWLFLSSEEQMCGTHRETKKMFCEVDKSLLCSPCSSS
QEHRDHRHCPIEWAAEEHREKLLQKMQSLWEKACENHSNLNVENTRTRHWKAFGDTLYRT
ESVLLHMPQPLNPELSAGPITGLMDRLNQF
Download sequence
Identical sequences ENSNLEP00000000810 ENSNLEP00000000810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]