SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000812 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000812
Domain Number 1 Region: 126-232
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.25e-28
Family DEP domain 0.00000352
Further Details:      
 
Domain Number 2 Region: 242-351
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-25
Family Pleckstrin-homology domain (PH domain) 0.00000342
Further Details:      
 
Domain Number 3 Region: 4-136
Classification Level Classification E-value
Superfamily PH domain-like 5.65e-25
Family Pleckstrin-homology domain (PH domain) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000812   Gene: ENSNLEG00000000680   Transcript: ENSNLET00000000862
Sequence length 353
Comment pep:known_by_projection supercontig:Nleu1.0:GL397292.1:1675637:1707162:-1 gene:ENSNLEG00000000680 transcript:ENSNLET00000000862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGVLKEGFLVKRGHIVHNWKARWFILRQNTLVYYKLEGGRRVTPPKGRILLDGCTITC
PCLEYENRPLLIKLKTQTSTEYFLEACSREERDAWAFEITGAIHAGQPGKVQQLHSLRNS
FKLPPHISLHRIVDKMHDSSTGIRSSPNMEQGSTYKKTFLGSSLVDWLISNSFTANRLEA
VTLASMLMEENFLRPVGVRSMGAIRSGDLAEQFLDDSTALYTFAESYKKKISPKEEISLS
TVELSGTVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKDENRPVGGFSLRGSL
VSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIKKLT
Download sequence
Identical sequences G1QIR8
XP_003263639.1.23891 ENSNLEP00000000812 ENSNLEP00000000812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]