SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000814 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000814
Domain Number 1 Region: 110-358
Classification Level Classification E-value
Superfamily vWA-like 7.45e-82
Family Integrin A (or I) domain 0.0000000228
Further Details:      
 
Domain Number 2 Region: 354-443
Classification Level Classification E-value
Superfamily Integrin domains 2.51e-30
Family Integrin domains 0.0001
Further Details:      
 
Domain Number 3 Region: 610-692
Classification Level Classification E-value
Superfamily Integrin beta tail domain 9.55e-19
Family Integrin beta tail domain 0.00034
Further Details:      
 
Domain Number 4 Region: 3-55
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000241
Family Plexin repeat 0.00072
Further Details:      
 
Domain Number 5 Region: 569-609
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000103
Family Integrin beta EGF-like domains 0.0032
Further Details:      
 
Domain Number 6 Region: 526-564
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000502
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000000814
Domain Number - Region: 495-526
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0276
Family Integrin beta EGF-like domains 0.033
Further Details:      
 
Domain Number - Region: 451-478
Classification Level Classification E-value
Superfamily EGF/Laminin 0.053
Family Integrin beta EGF-like domains 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000814   Gene: ENSNLEG00000000687   Transcript: ENSNLET00000000864
Sequence length 776
Comment pep:known_by_projection supercontig:Nleu1.0:GL397380.1:3206145:3315303:-1 gene:ENSNLEG00000000687 transcript:ENSNLET00000000864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVRNGCGGEIESPA
SSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTFQLQVRQVEDYPVDLYYL
MDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFGSFVDKDISPFSYTAPRYQTNPCI
GYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVSRNRDAPEGGFDAVLQAAVCKEKI
GWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQCHLNEANEYTASNQMDYPSLALLG
EKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEILDGDSKNIIQLIINAYNSIRSKVE
LSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSVEARSCPSRHTEHVFA
LRPVGFRDSLEVGVTYNCTCGCSVGLEPSSARCSGSGTYVCGLCECSPGYLGTRCECQDG
ENQSVYQNLCREAEGKPLCSGRGECSCNQCSCFESEFGKIYGPFCECDNFSCARNKGVLC
SGHGECHCGECKCHAGYIGDNCNCSTDISTCRGRDGQICSERGHCLCGQCQCTEPGAFGE
MCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSLCRDEVITWVDTIVKDDQEAVLCF
YKTAKDCVMMFTYAELPSGKSNLTVLREPECGNTPNAMTILLAVVGSILLVGLALLAIWK
LLVTIHDRREFAKFQSERSRARYEMASNPLYRKPISTHTVDFTFNKFNKSYNGTVD
Download sequence
Identical sequences ENSNLEP00000000814 ENSNLEP00000000814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]