SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000818 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000818
Domain Number 1 Region: 124-225
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000273
Family I set domains 0.014
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000000818
Domain Number - Region: 4-19
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00911
Family I set domains 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000818   Gene: ENSNLEG00000000690   Transcript: ENSNLET00000000868
Sequence length 291
Comment pep:known_by_projection supercontig:Nleu1.0:GL397406.1:310044:316700:1 gene:ENSNLEG00000000690 transcript:ENSNLET00000000868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAEEDTGTYECRASNDPDRNHLARAPTVKWVRAQAVVLVLEREWRAPPSPPPSVSLLCR
SPPGSCSEFCGGSDLTGTVLLFHCAVVGPLENPGVDSDNRWGEYSCVFLPEPTRRADIQL
TQLHGPPRVKAVKSSEHINEGETAVLACKSESMPPVTDWVWHKITDSGDQVRSQGCWGRF
FVSSSQGRSELHIENLNMEADPGQYRCNGTSSEGTDEAVITLRVRSHLAALWPFLGIVAE
VLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS
Download sequence
Identical sequences ENSNLEP00000000818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]