SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000877 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000877
Domain Number 1 Region: 474-801
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.97e-63
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000214
Further Details:      
 
Domain Number 2 Region: 807-934
Classification Level Classification E-value
Superfamily Ricin B-like lectins 9.24e-20
Family Ricin B-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000877   Gene: ENSNLEG00000000734   Transcript: ENSNLET00000000934
Sequence length 939
Comment pep:known_by_projection supercontig:Nleu1.0:GL397304.1:2445170:2506840:1 gene:ENSNLEG00000000734 transcript:ENSNLET00000000934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRIRKFFRGSGRVLAFIFVASVIWLLFDMAALRLSFSEINTRVIKEDIVRRERIGFRVQ
PDQGKIFYSSIKEMKPPLKGHGKGAWGKENDRKTEESVLKVEVDLDQTQRERKMQNALGR
GKVVPLWHPAHLQTLPVTPNKQKTDGRGTKPEASSHQGTPKQTTAQGAPKTSFIAAKGTQ
VVKISVHTGRVSLKQEPLKSHSPSSDTSKPAAERDLNVTISLSTDRPKQRSQVLAKERAH
PASTAVPKSGEAMALNKTKTQSKEVNANKHKNTSLPFPKFIVNSNRLRKQSINEISLGSL
SKDDEARGAHGKKLNFSESHVVIITKEEEQKADPKEVSNSKTKTIFPKVLGKSQGKHISR
NRSEMSFSSLAPHRVPLSQTNYALTGGLEPTKINITAKAPPTKYNQSHIKALLPEDSGMH
QVLRIDVTLSPRDPKAPGQFGRPVVVPHGKEKEAERRWKEGNFNVYLSDLIPVDRAIEDT
RPAGCAEQLVHNNLPTTSVIMCFVDEVWSTLLRSVHSVLNRSPPHLIKEILLVDDFSTKD
YLKDNLDKYMSQFPKVRILRLKERHGLIRARLAGAQNATGDVLTFLDSHVECNVGWLEPL
LERVYLSRKKVACPVIEVINDKDMSYMTVDNFQRGIFVWPMNFGWKTIPPDVIAKNRIKE
TDIIRCPVMAGGLFSIDKSYFFELGTYDPGLDVWGGENMELSFKVWMCGGEIEIIPCSRV
GHIFRNDNPYSFPKDRMKTVERNLVRVAEVWLDEYKELFYGHGDHLIDQGLDVGNLTQQR
ELRKKLKCKSFKWYLENVFPDLKAPIVRASGVLINVALGKCISIENTTVILEDCDGSKEL
QQFNYTWLRLIKCGEWCIAPIPDKGAVRLHPCDDRNKGLKWLHKSTSVFHPELVNHIVFE
NNQQLLCLEGNFSQKILKVAACDPVKPYQKWEFEKYYEA
Download sequence
Identical sequences ENSNLEP00000000877 ENSNLEP00000000877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]