SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000953 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000953
Domain Number 1 Region: 940-1234
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-79
Family Protein kinases, catalytic subunit 0.0000000000945
Further Details:      
 
Domain Number 2 Region: 296-461
Classification Level Classification E-value
Superfamily L domain-like 1.11e-51
Family L domain 0.0000000575
Further Details:      
 
Domain Number 3 Region: 5-158
Classification Level Classification E-value
Superfamily L domain-like 3.4e-42
Family L domain 0.000000115
Further Details:      
 
Domain Number 4 Region: 580-633,757-895
Classification Level Classification E-value
Superfamily Fibronectin type III 3.52e-32
Family Fibronectin type III 0.0000893
Further Details:      
 
Domain Number 5 Region: 458-557
Classification Level Classification E-value
Superfamily Fibronectin type III 2.86e-27
Family Fibronectin type III 0.0000233
Further Details:      
 
Domain Number 6 Region: 139-298
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.29e-16
Family Growth factor receptor domain 0.0000000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000953   Gene: ENSNLEG00000000814   Transcript: ENSNLET00000001012
Sequence length 1337
Comment pep:known_by_projection supercontig:Nleu1.0:GL397416.1:724330:976771:1 gene:ENSNLEG00000000814 transcript:ENSNLET00000001012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVCGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVITEYLLLFRV
AGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLC
YLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNR
CQKMCPSACGKRACTENNECCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYR
FEGWRCVDRDFCANILSAESSDSEGFVIHDGECMQECPSGFIRNGSQSMYCIPCEGPCPK
VCEEEKKTKTIDSVTSAQMLQGCTIFKGNLLINIRRGNNIASELENFMGLIEVVTGYVKI
RHSHALVSLSFLKNLRLILGEEQLEGNYSFYVLDNQNLQQLWDWDHRNLTIKAGKMYFAF
NPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNGERASCESDVLHFTSTTTWKNRIIITWH
RYRPPDYRDLISFTVYYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNKDVEPGILLHG
LKPWTQYAVYVKAVTLTXXXXXXXXXXXHFLECSLFPFPVPSIPLDVLSASNSSSQLIVK
WNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSKXXIPIRKYADGTIDIEEVTENPKTE
VCGGEKGPCCACPKTEAEKQAEKEEAEYRKVFENFLHNSIFVPRPERKRRDIMQVANSTT
SSRSRNTTATDAYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEA
EKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYG
SQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGY
ENFIHLIIALPVAVLLIVGGLVIMLYVFHRKRNNSRLGNGVLYASVNPEYFSAADVYVPD
EWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNE
ASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLS
KMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGG
KGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGL
LDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKDEMEPGFREVSFYYSEENKLPEP
EELDLEPENMESVPLDPSASSSSLPLPDRHSGHKAENGPGPGVLVLRASFDERQPYAHMN
GGRKNERALPLPQSSTC
Download sequence
Identical sequences ENSNLEP00000000953 ENSNLEP00000000953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]