SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000959 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000959
Domain Number 1 Region: 3-124
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 5.49e-30
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000959   Gene: ENSNLEG00000000830   Transcript: ENSNLET00000001018
Sequence length 142
Comment pep:known_by_projection supercontig:Nleu1.0:GL397416.1:987787:1043942:-1 gene:ENSNLEG00000000830 transcript:ENSNLET00000001018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTAAKAIILEQSGKNQGYRDADIRGFRPEGGVCLPGGPDVLESGVCMKAVCKRVAVEGV
EVIFSRDAGRYVCDYTYYLSLHHGKGCAALIHVPPLSRGLPASLLGRVLQVIIQEMLEEV
GKPKHKAPFEENSTMALPAKGN
Download sequence
Identical sequences ENSNLEP00000000959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]