SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000977 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000977
Domain Number 1 Region: 139-359
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.15e-59
Family Ankyrin repeat 0.00015
Further Details:      
 
Domain Number 2 Region: 6-108
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000762
Family Fibronectin type III 0.00000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000977   Gene: ENSNLEG00000000831   Transcript: ENSNLET00000001038
Sequence length 371
Comment pep:known_by_projection supercontig:Nleu1.0:GL397421.1:1940894:2064045:1 gene:ENSNLEG00000000831 transcript:ENSNLET00000001038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPQKITPPSKPHPPVVGKVTHHSIELYWDVEKKAKRQGPQEQWFRFSIEEKDPNMHTYG
IIYTGYATKHVVEGLEPRTQYRFRLKVTSPSGECEYSPLVSVSTTRPSLSKNIVKIRVVT
SVLHGPPTENTGEPISSEHLHRAVSVNDEDLLVQILQGGRVKVDVPNKFGFTALMVAAQK
GYTRLVKILVSNGTDVNLKNGSGKDSLMLACYAGHLDIVKYLRRHGASWQARDLGGCTAL
HWAADGGHCSVIEWMINDGCEVDIADTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVK
DRNGKTPLMVAVLNNHEELVQLLLDKGADASVKNEFGKGVLEMARVFDRQSVVSLLEERK
KKQRPKKSCVC
Download sequence
Identical sequences ENSNLEP00000000977 ENSNLEP00000000977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]