SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001003 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001003
Domain Number 1 Region: 285-413
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000785
Family Growth factor receptor domain 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000001003
Domain Number - Region: 174-202
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00469
Family Laminin-type module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001003   Gene: ENSNLEG00000000852   Transcript: ENSNLET00000001064
Sequence length 840
Comment pep:known_by_projection supercontig:Nleu1.0:GL397491.1:1642982:1655496:-1 gene:ENSNLEG00000000852 transcript:ENSNLET00000001064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLSPPTELAAMGLGLLLPLLLLWTQGTQGSELDPNGQHVCVASSPSAELQCCAGWRQKD
QECTIPICEGPDACQKDEVCVKPGLCRCKPGFFGAHCSSRCPGQYWGPDCRESCPCHPHG
QCEPATGACQCQADRWGARCEFPCACGPHGRCDPATGVCHCEPGWWSSTCRRPCQCNPAA
ARCEQATGACVCKPGWWGRRCSFRCACHGSPCEQDSGRCACRPGWWGPECRQQCECVRGR
CSAASGECTCPPGFRGARCELPCPAGSHGVQCAHSCGHCKHNEPCSPDTGSCESCEPGWN
GTQCQQPCLPGTFGESCEQQCLHCQHGEACEPDTGHCQRCDPGWLGPRCEDLCPTGTFGE
DCGSTCPTCVQGACDAVTGECVCSAGYWGPSAHKSPCPSPACLPNFTQPSACLSMMCRRQ
EGLSVPRSHRRDAALIAGSLVPLLLLFLGLICCACCCWATRSDLKDRPARDGATVSRMKL
QVWGTLTSLGSTLPCGSLSSHKLPWVTVSHHDPEVPFNHSFIEPPSAGWASDDSFSSDPE
SGEADEGPAYCVPPQEGMVPVAQAESSEASLAAGAFPPPEDASTPFAIPRTSSLARAKRP
SVSFAEGTKFAPQSRRSSGELSSPLRKPKRLSRGAQSGPEGREAEESTGPEEAEAHESFP
AAASPGDSATGHRRPPLGGRTVAEHVEAIEGSVQESSGPVTTIYMLAGTPQGPEGPVRSV
FRHFGSFQKGQAEPKVKRAIPKPPRQALNRKKGPGLASGSVSQSPNSAPKAGLPGATGPV
AVRPEEAAQGLGAGMESSGRAQKPISGGGSPKRDPQKQAKEERQEEPEYENVVRIRPPEP
Download sequence
Identical sequences ENSNLEP00000001003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]