SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001026 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001026
Domain Number 1 Region: 493-801
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.89e-99
Family PDEase 0.000000626
Further Details:      
 
Domain Number 2 Region: 234-278,305-454
Classification Level Classification E-value
Superfamily GAF domain-like 3.61e-31
Family GAF domain 0.00071
Further Details:      
 
Domain Number 3 Region: 52-247
Classification Level Classification E-value
Superfamily GAF domain-like 5.45e-30
Family GAF domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001026   Gene: ENSNLEG00000000873   Transcript: ENSNLET00000001087
Sequence length 829
Comment pep:known_by_projection supercontig:Nleu1.0:GL397499.1:613611:658556:1 gene:ENSNLEG00000000873 transcript:ENSNLET00000001087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSEEQARSFLDQNPDFAHQYFGKKLSPENVAAACEDGCPPGCHSLRELCQVEESTALL
ELVQDMQESINMERVVFKILRRLCTLLQADRCSLFMYRQRNGVAELATRLFSVQPDSVLE
DCLVPPDSEIVFPLDIGVVGHVAQTKKMVNVKDVAECPHFSSFADELTEYKTKNMLATPI
MNGKDVVAVIMARLCARPVHMSLCEHVFLKYLNFATLYLKIYHLSYLHNCETRRGQVLLW
SANKVFEELTDIERQFHKAFYTVRAYLNCERYSVGLLDMTKEKEFFDVWPVLMGESQPYS
GPRTPDGREIIFYKVIDYILHGKEEIKVIPTPPADHWALASGLPSYVAESGFICNIMNAS
ADEMFKFQEGALDDSGWLIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEQDEVLMESL
TQFLGWSVMNTDTYDKMNKLENRKDIAQDMVLYHVKCDRDEIQLILPTRARLGKEPADCD
EDELGKILKEELPGPTTFDIYEFHFSDLECTELDLVKCGIQMYYELGVVRKFQIPQEVLV
RFLFSISKGYRRITYHNWRHGFNVAQTMFTLLMTGKLKSYYTDLEAFAMVTAGLCHDIDH
RGTNNLYQMKRHHRAHTLNIYQNLNRQHEHVIHLMDIAIIATDLALYFKKRAMFQKIVDE
SKNYEDKKSWVEYLSLETTRKEIVMAMMMTACDLSAITKPWEVQSKVALLVAAEFWEQGD
LERTVLDQQPIPMMDRNKAAELPKLQVGFIDFVCTFVYKEFSRFHEEILPMFDRLQNNRK
EWKALADEYEAKVKALEEKKEEERVAVKKVGTEICNGGPAPKSSTCCVL
Download sequence
Identical sequences ENSNLEP00000001026 ENSNLEP00000001026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]