SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001028 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001028
Domain Number 1 Region: 1189-1411
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.2e-63
Family DBL homology domain (DH-domain) 0.0000000254
Further Details:      
 
Domain Number 2 Region: 1103-1187
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-27
Family SH3-domain 0.00000321
Further Details:      
 
Domain Number 3 Region: 230-332
Classification Level Classification E-value
Superfamily EF-hand 4.02e-27
Family Eps15 homology domain (EH domain) 0.0024
Further Details:      
 
Domain Number 4 Region: 8-107
Classification Level Classification E-value
Superfamily EF-hand 5.54e-26
Family Eps15 homology domain (EH domain) 0.0019
Further Details:      
 
Domain Number 5 Region: 868-957
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-19
Family SH3-domain 0.0000161
Further Details:      
 
Domain Number 6 Region: 979-1040
Classification Level Classification E-value
Superfamily SH3-domain 5.25e-19
Family SH3-domain 0.0000294
Further Details:      
 
Domain Number 7 Region: 1048-1118
Classification Level Classification E-value
Superfamily SH3-domain 9.71e-16
Family SH3-domain 0.0000201
Further Details:      
 
Domain Number 8 Region: 760-837
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000002
Family SH3-domain 0.0000209
Further Details:      
 
Domain Number 9 Region: 1411-1492
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000178
Family Pleckstrin-homology domain (PH domain) 0.0000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001028   Gene: ENSNLEG00000000860   Transcript: ENSNLET00000001089
Sequence length 1502
Comment pep:known_by_projection supercontig:Nleu1.0:GL397331.1:3352316:3486783:-1 gene:ENSNLEG00000000860 transcript:ENSNLET00000001089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAQFPTAMNGGPNMWAITSEERTKHDRQFDNLKPSGGYITGDQARNFFLQSGLPAPVLA
EIWALSDLNKDGKMDQQEFSIAMKLIKLKLQGQQLPVVLPPIMKQPPMFSPLISARFGMG
SMPNLSIPQPLPPAAPITSLSSATSGTNLPPLMMPTPLVPSVSTSSLPNGTASLIQPLPI
PYSSSTLPHGSSYTLMMGGFGGASIQKAQSLIDLGSSSSTSSTASLSGNSPKTGTSEWAV
PQPTRLKYRQKFNSLDKSMSGYLSGFQARNALLQSNLSQTQLATIWTLADIDGDGQLKAE
EFILAMHLTDMAKAGQPLPLTLPPELVPPSFRGGKQIDSINGTLPSYQKMQEEEPQKKLP
VTFEDKRKANYERGNMELEKRRQALMEQQQREAERKAQKEKEEWERKQRELQEQEWKKQL
ELEKRLEKQRELERQREEERRKEIERREAAKQELERQRRLEWERIRRQELLNQKNREQEE
IVRLNSKKKSLHLELEALNGKHQQISGRLQDVRLKKQTQKTELEVLDKQCDLEIMEIKQL
QQELQEYQNKLVYLVPEKQLLNERIKNMQFSNTPDSGVSLLHKKSLEKEELCQRLKEQLD
ALEKETASKLSEMDSFNNQLKCGNMDDSVLQCLLSLLSCLNNLFLLLKELRETYNTQQLA
LEQLYKIKRDKLKEIERKRLELIQKKKLEDEAARKAKQGKENLWKENLRKEEEEKQKRLQ
EEKTQEKIQEEGRKTEEKQRKDKDTLKAEEKKRKDKDTLRHSVLYEFQIRVRSQISFSSL
SIVNVDEKTIGEPGWLYGGFQGNFGWFPCNYVEKMPSSENEKAVSPKKALLPPTVSLSAT
STSSEPLTSNQPASVTDYQNVSFSNLTVNTSWQKKSAFTRTVSPGSVSPIHGQGQVVENL
KAQALCSWTAKKDNHLNFSKHDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPGSEVKR
EEPEALYAAVNKKPTSAAYSVGEEYIALYPYSSVEPGDLTFTEGEEILVTQKDGEWWTGS
IGDRSGIFPSNYVKPKDQESFGSASKSGASNKKPEIAQVTSAYVASGSEQLSLAPGQLIL
ILKKNTSGWWQGELQARGKKRQKGWFPASHVKLLGPSSERATPAFHPVCQVIAMYDYAAN
NEDELSFSKGQLINVMNKDDPDWWQGEINGVTGLFPSNYVKMTTDSDPSQQWCADLQTLD
TMQPIERKRQGYIHELIQTEERYMADLQLVIEVFQKRMAESGFLTEGEMALIFVNWKELI
MSNTKLLKALRVRKKTGGEKMPVQMIGDILAAELSHMQAYIRFCSCQLNGAALLQQKTDE
DTDFKEFLKKLASDPRCKGMPLSSFLLKPMQRITRYPLLIRSILENTPESHADHSSLKLA
LERAEELCSQVNEGVREKENSDRLEWIQAHVQCEGLAEQLIFNSLTNCLGPRKLLHSGKL
YKTKSNKELHGFLFNDFLLLTYMVKQFAVSSGSEKVFSSKSNAQFKMYKTVSIARLALAS
GA
Download sequence
Identical sequences ENSNLEP00000001028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]