SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001054 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001054
Domain Number 1 Region: 25-124
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000182
Family V set domains (antibody variable domain-like) 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001054   Gene: ENSNLEG00000000878   Transcript: ENSNLET00000001116
Sequence length 389
Comment pep:known_by_projection supercontig:Nleu1.0:GL397352.1:874889:894472:-1 gene:ENSNLEG00000000878 transcript:ENSNLET00000001116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFWLWPLYFLPISGALRILPEVKVEGELGGSVTIKCPLPEMHMRIYLCRMAGSGTCGTV
VSTTNFIKAEYKGRVTLKQRPHKNLFLVEVTQLTESDSGVYACGAGMNTDRGKTKKVTLN
VHSEYEPSWEEQPMAKTPKWFHLPYLFQMPAYTSSSKFVTRVTTPAQRTKVPPVHHSSPT
TQITHRPRVSRASSVAGDKPPTFLPSSTASKISALEGLLKPQTPSYNHHTRLHRQRALDY
GSQSGREGQGFHILVPTILGLFLLALLGLVVKRAVERRKALSRRARRLAVRMRALESSQR
PRGSPRPRSQNNIYSACPRRARGADAAGKGEAPVPGSGAPLPPAPLQVSESPWLHAPSLK
TSCEYVSLYHQPATKMEDSDSDDYINVPA
Download sequence
Identical sequences G1QJG0
ENSNLEP00000001054 XP_003273016.1.23891 ENSNLEP00000001054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]