SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001075 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001075
Domain Number 1 Region: 13-71
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000145
Family RING finger domain, C3HC4 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001075   Gene: ENSNLEG00000000920   Transcript: ENSNLET00000001139
Sequence length 247
Comment pep:known_by_projection supercontig:Nleu1.0:GL397291.1:4796787:4855964:1 gene:ENSNLEG00000000920 transcript:ENSNLET00000001139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASQPPEDTVETQASDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQG
VIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVS
PSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQT
SIRVLVWLLGLLYFSSLPLGIYLLVSKKVTLGVVFVSLVPSSLVILMVYGFCQCVCHEFL
DCMAPPS
Download sequence
Identical sequences G1QJI1
ENSNLEP00000001075 XP_003263580.1.23891 XP_003263581.1.23891 XP_012364237.1.23891 XP_012364238.1.23891 XP_012364239.1.23891 XP_012364240.1.23891 ENSNLEP00000001075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]