SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001084 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001084
Domain Number 1 Region: 32-212
Classification Level Classification E-value
Superfamily vWA-like 1.64e-40
Family Integrin A (or I) domain 0.00059
Further Details:      
 
Domain Number 2 Region: 334-421
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000492
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 3 Region: 214-301
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000541
Family Fibronectin type III 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001084   Gene: ENSNLEG00000000929   Transcript: ENSNLET00000001148
Sequence length 443
Comment pep:known_by_projection supercontig:Nleu1.0:GL398410.1:6442:13913:1 gene:ENSNLEG00000000929 transcript:ENSNLET00000001148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPWTALGLALSLRLALARSGAERGXXXXXPQGDLMFLLDSSASVSHYEFSRVREFVGQL
VAPLPLGTGALRASLVHVGSRPYTEFPFGQHSSGKAAQDAVRASAQRMGDTHTGLALVYA
KEQLFAEASGARPGVPKVLVWVTDGGSSDPVGPPMQELKDLGVTVFIVSTGRGNFLELSA
AASAPAEKHLHFVDVDDLHIIVQELRGFILDAMRPQQLHATEITSSGFRLAWPPLLTADS
GYYVLELVPSAQPGAARRQQLPGNATDWTWAGLDPDTDYDVALVPESNVRLLRPQNLRVR
TRPREAGPGASGPESGAGPAPTQLAALPAPEEAGPERIVISHARPRSLRVSWAPALGSAA
ALGYHVQFGPLGGGAAQRVEVPAGRNCTTLQGLAPGTAYLVTVTVAFRSGRESALSAKAC
TPDGPRPRPVPRAPTPGTTSREP
Download sequence
Identical sequences ENSNLEP00000001084 ENSNLEP00000001084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]