SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001143 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001143
Domain Number 1 Region: 42-393
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.37e-44
Family beta-glycanases 0.028
Further Details:      
 
Domain Number 2 Region: 384-550
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.33e-37
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000001143
Domain Number - Region: 541-648
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000239
Family Fibronectin type III 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001143   Gene: ENSNLEG00000000973   Transcript: ENSNLET00000001210
Sequence length 652
Comment pep:known_by_projection supercontig:Nleu1.0:GL397499.1:1015797:1035057:1 gene:ENSNLEG00000000973 transcript:ENSNLET00000001210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLSPRAALLALLASLLAAPPVAPTEAPHLVQVDAARALWPLRRFWRSTGFCPPLPHSQ
ADQYLLSWDQQLNLAYVGAVPHRGIEQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDL
LRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGGQAQALGPWPGXXXX
XXXXXXXDNVSMTLQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHC
HDGTNFFTGEAGARLDYISLHRKGARSSISILEQEKAVAQQIRQLFPKFADTPIYNDEAD
PLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTSSAFPYALLSNDNAFLSYHPHPFA
QRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSRAGTVLDSNHTVGVL
ASAHRPQGPADAWRAAVLIYASDDTRAHPNGSVAVTLRLRGVPPGPGLVYVTRYLDNRLC
SPDGEWRRLGRPVFPSAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVC
ARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPST
FNLFVFSPDTGAVSGSYRVRALDYWARPGPFSNPVPYLEVPAPRGPPPPGSP
Download sequence
Identical sequences ENSNLEP00000001143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]