SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001148 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001148
Domain Number 1 Region: 7-94
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 2.36e-39
Family MHC antigen-recognition domain 0.0000118
Further Details:      
 
Domain Number 2 Region: 101-189
Classification Level Classification E-value
Superfamily Immunoglobulin 5.74e-27
Family C1 set domains (antibody constant domain-like) 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001148   Gene: ENSNLEG00000000928   Transcript: ENSNLET00000001215
Sequence length 236
Comment pep:novel supercontig:Nleu1.0:GL398385.1:9661:15761:-1 gene:ENSNLEG00000000928 transcript:ENSNLET00000001215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VHVPTARFLEQFKGECHFFNGTERVRLLVRFFYNQEEFVRFDSDVGEYRAVTELGRPIAE
HLNSQKDSLERRRAEVDTVCRHNYGGVESFTVQRRVHPEVTVYPSKTQPLQHHNLLVCSV
SGFYPGSIEVKWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPS
VTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLSQQDS
Download sequence
Identical sequences ENSNLEP00000001148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]