SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001154 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001154
Domain Number 1 Region: 534-561,604-687
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.55e-16
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001154   Gene: ENSNLEG00000000982   Transcript: ENSNLET00000001221
Sequence length 701
Comment pep:known_by_projection supercontig:Nleu1.0:GL397499.1:1016367:1022445:-1 gene:ENSNLEG00000000982 transcript:ENSNLET00000001221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDESPEPLQQGRGLVLVRRQRPAPQGLREMLKARLWRSCSCSVLCARALVQDLLPATRWL
RQYRPREYLAGDVMSGLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANLIYFLMGTSRH
VSVGIFSLLCLMVGQVVDRELQLAGFDPSQDGLQPGANSSILNSSAAMLDCGRDCYAIRV
ATALTLMTGLYQVLMGVLRLGFVSAYLSQPLLDGFAMGASVTILTSQLKHLLGVRIPRHQ
GPGMVVLTWLSLLRSAGQANVCDVVTSTVCLAVLLAAKELSDRYRHRLRVPLPTELLVIV
VATLVSHFGQLHKRFGSSVAGDIPTGFMPPQVPEPRLMQRVALDAVALALVGAAFSISLA
EMFARSHGYSVRANQELLAVGCCNVLPAFLHCFATSAALAKSLVKTATGCRTQLSSVVSA
TVVLLVLLALAPLFHDLQRSVLACVIVVSLRGALRKVWDLPRLWRMSPADALVWAGTAAT
CMLVSTEAGLLAGVILSLFSLAGRTQRPHAALLARIGDSAFYEDATEFEGLVPEPGVRVF
RFGGPLYYANKDFFLRSLYSLTGLDAGCMAARRKEGGSERGVGEGGPAQGEVLGPVSSRA
ALVPAAAGFHTVVIDCAPLLFLDAAGVTTLQDLRRDYRALGISLLLACCNPPVRDILSRG
GFLGEGPRDMAEEEQLFLSVHDAVQTARARHRELEATDAHL
Download sequence
Identical sequences G1QJQ9
XP_003280599.1.23891 XP_003280600.1.23891 ENSNLEP00000001154 ENSNLEP00000001154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]